Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.8: PFOR Pyr module [88746] (1 protein) domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain I [88747] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [88748] (10 PDB entries) |
Domain d2c3ub1: 2c3u B:2-258 [129775] Other proteins in same PDB: d2c3ua2, d2c3ua3, d2c3ua4, d2c3ua5, d2c3ub2, d2c3ub3, d2c3ub4, d2c3ub5 automatically matched to d1b0pa1 complexed with 2tp, ca, mg, pyr, sf4 |
PDB Entry: 2c3u (more details), 2.32 Å
SCOPe Domain Sequences for d2c3ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3ub1 c.36.1.8 (B:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg ivaeymqkvasltgrsy
Timeline for d2c3ub1: