![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
![]() | Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein) |
![]() | Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species) |
![]() | Species Desulfovibrio africanus [TaxId:873] [52933] (10 PDB entries) |
![]() | Domain d2c3pa3: 2c3p A:259-415 [129762] Other proteins in same PDB: d2c3pa1, d2c3pa2, d2c3pa4, d2c3pa5, d2c3pb1, d2c3pb2, d2c3pb4, d2c3pb5 automated match to d1keka3 complexed with 1tp, ca, mg, sf4 |
PDB Entry: 2c3p (more details), 2.33 Å
SCOPe Domain Sequences for d2c3pa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3pa3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]} klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv ydnmsgakknhftvgieddvtgtslpvdnafadttpk
Timeline for d2c3pa3: