Lineage for d2c3pb2 (2c3p B:786-1232)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.12: PFOR PP module [88771] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
  6. Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI [88772] (1 species)
  7. Species Desulfovibrio africanus [TaxId:873] [88773] (10 PDB entries)
  8. Domain d2c3pb2: 2c3p B:786-1232 [129766]
    Other proteins in same PDB: d2c3pa1, d2c3pa3, d2c3pa4, d2c3pa5, d2c3pb1, d2c3pb3, d2c3pb4, d2c3pb5
    automated match to d1keka2
    complexed with 1tp, ca, mg, sf4

Details for d2c3pb2

PDB Entry: 2c3p (more details), 2.33 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c3pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3pb2 c.36.1.12 (B:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]}
vksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcssiwg
asapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesdasgd
vkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifggdgw
aydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtgkkdl
armvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmgksqd
vmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsfpeda
krlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtpmmar
pdsgeacdqnragtseqqgdlskrtkk

SCOPe Domain Coordinates for d2c3pb2 are not available.

Timeline for d2c3pb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c3pb1, d2c3pb3, d2c3pb4, d2c3pb5
View in 3D
Domains from other chains:
(mouse over for more information)
d2c3pa1, d2c3pa2, d2c3pa3, d2c3pa4, d2c3pa5