![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
![]() | Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82726] (1 species) |
![]() | Species Xanthobacter sp., py2 [TaxId:35809] [82727] (4 PDB entries) |
![]() | Domain d2c3ca3: 2c3c A:384-523 [129727] Other proteins in same PDB: d2c3ca1, d2c3ca2, d2c3cb1, d2c3cb2 automatically matched to d1mo9a3 complexed with acn, com, fad, nap |
PDB Entry: 2c3c (more details), 2.15 Å
SCOPe Domain Sequences for d2c3ca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3ca3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} pknypdflhthyevsflgmgeeearaagheivtikmppdtenglnvalpasdrtmlyafg kgtahmsgfqkividaktrkvlgahhvgygakdafqylnvlikqgltvdelgdmdelfln pthfiqlsrlragsknlvsl
Timeline for d2c3ca3: