Lineage for d2c3ca3 (2c3c A:384-523)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528292Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2528293Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2528392Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82726] (1 species)
  7. 2528393Species Xanthobacter sp., py2 [TaxId:35809] [82727] (5 PDB entries)
  8. 2528398Domain d2c3ca3: 2c3c A:384-523 [129727]
    Other proteins in same PDB: d2c3ca1, d2c3ca2, d2c3cb1, d2c3cb2
    automated match to d1mo9a3
    complexed with acn, com, fad, nap

Details for d2c3ca3

PDB Entry: 2c3c (more details), 2.15 Å

PDB Description: 2.01 angstrom x-ray crystal structure of a mixed disulfide between coenzyme m and nadph-dependent oxidoreductase 2-ketopropyl coenzyme m carboxylase
PDB Compounds: (A:) 2-oxopropyl-com reductase

SCOPe Domain Sequences for d2c3ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3ca3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}
pknypdflhthyevsflgmgeeearaagheivtikmppdtenglnvalpasdrtmlyafg
kgtahmsgfqkividaktrkvlgahhvgygakdafqylnvlikqgltvdelgdmdelfln
pthfiqlsrlragsknlvsl

SCOPe Domain Coordinates for d2c3ca3:

Click to download the PDB-style file with coordinates for d2c3ca3.
(The format of our PDB-style files is described here.)

Timeline for d2c3ca3: