Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (scop_cf 54075) |
Superfamily d.294.1: EndoU-like [142877] (2 families) similarity to the RNase A-like superfamily (scop_sf 54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
Family d.294.1.1: Eukaryotic EndoU ribonuclease [142878] (1 protein) PfamB 010233; common fold decorated with additional structures |
Protein EndoU [142879] (1 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [142880] (1 PDB entry) |
Domain d2c1wc1: 2c1w C:6-287 [129646] automatically matched to 2C1W A:6-289 complexed with po4 |
PDB Entry: 2c1w (more details), 2.2 Å
SCOP Domain Sequences for d2c1wc1:
Sequence, based on SEQRES records: (download)
>d2c1wc1 d.294.1.1 (C:6-287) EndoU {African clawed frog (Xenopus laevis) [TaxId: 8355]} gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvpagsnqardsasfplfqfvde eklksrktfatfislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrk nqakptrndfkvqlyniwfqlysrapgsrpdscgfehvfvgeskrgqemmglhnwvqfyl qekrknidykgyvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytiv flasqekmsrevvrleeyelqivvnrhgryigtaypvllstn
>d2c1wc1 d.294.1.1 (C:6-287) EndoU {African clawed frog (Xenopus laevis) [TaxId: 8355]} gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvsfplfqfvdeeklksrktfat fislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrknqakptrndfk vqlyniwfqlysrapgsrpdscgfehvfvgeskrgqemmglhnwvqfylqekrknidykg yvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytivflasqekmsre vvrleeyelqivvnrhgryigtaypvllstn
Timeline for d2c1wc1: