Lineage for d2c1wc1 (2c1w C:6-287)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741509Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (scop_cf 54075)
  4. 741510Superfamily d.294.1: EndoU-like [142877] (2 families) (S)
    similarity to the RNase A-like superfamily (scop_sf 54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 741511Family d.294.1.1: Eukaryotic EndoU ribonuclease [142878] (1 protein)
    PfamB 010233; common fold decorated with additional structures
  6. 741512Protein EndoU [142879] (1 species)
  7. 741513Species African clawed frog (Xenopus laevis) [TaxId:8355] [142880] (1 PDB entry)
  8. 741516Domain d2c1wc1: 2c1w C:6-287 [129646]
    automatically matched to 2C1W A:6-289
    complexed with po4

Details for d2c1wc1

PDB Entry: 2c1w (more details), 2.2 Å

PDB Description: the structure of xendou: a splicing independent snorna processing endoribonuclease
PDB Compounds: (C:) endou protein

SCOP Domain Sequences for d2c1wc1:

Sequence, based on SEQRES records: (download)

>d2c1wc1 d.294.1.1 (C:6-287) EndoU {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvpagsnqardsasfplfqfvde
eklksrktfatfislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrk
nqakptrndfkvqlyniwfqlysrapgsrpdscgfehvfvgeskrgqemmglhnwvqfyl
qekrknidykgyvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytiv
flasqekmsrevvrleeyelqivvnrhgryigtaypvllstn

Sequence, based on observed residues (ATOM records): (download)

>d2c1wc1 d.294.1.1 (C:6-287) EndoU {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvsfplfqfvdeeklksrktfat
fislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrknqakptrndfk
vqlyniwfqlysrapgsrpdscgfehvfvgeskrgqemmglhnwvqfylqekrknidykg
yvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytivflasqekmsre
vvrleeyelqivvnrhgryigtaypvllstn

SCOP Domain Coordinates for d2c1wc1:

Click to download the PDB-style file with coordinates for d2c1wc1.
(The format of our PDB-style files is described here.)

Timeline for d2c1wc1: