![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
![]() | Superfamily d.294.1: EndoU-like [142877] (3 families) ![]() similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
![]() | Family d.294.1.1: Eukaryotic EndoU ribonuclease [142878] (2 proteins) PfamB PB010233; common fold decorated with additional structures automatically mapped to Pfam PF09412 |
![]() | Protein automated matches [190536] (1 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [187504] (1 PDB entry) |
![]() | Domain d2c1wc_: 2c1w C: [129646] Other proteins in same PDB: d2c1wa1 automated match to d2c1wa1 complexed with po4 |
PDB Entry: 2c1w (more details), 2.2 Å
SCOPe Domain Sequences for d2c1wc_:
Sequence, based on SEQRES records: (download)
>d2c1wc_ d.294.1.1 (C:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvpagsnqardsasfplfqfvde eklksrktfatfislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrk nqakptrndfkvqlyniwfqlysrapgsrpdscgfehvfvgeskrgqemmglhnwvqfyl qekrknidykgyvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytiv flasqekmsrevvrleeyelqivvnrhgryigtaypvllstn
>d2c1wc_ d.294.1.1 (C:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} gqlnhelsklfnelwdadqnrmksgkdyrislqgkagyvsfplfqfvdeeklksrktfat fislldnyemdtgvaevvtpeeiaennnfldailetkvmkmahdylvrknqakptrndfk vqlyniwfqlysrapgsrpdscgfehvfvgeskrgqemmglhnwvqfylqekrknidykg yvarqnksrpdeddqvlnlqfnwkemvkpvgssfigvspefefalytivflasqekmsre vvrleeyelqivvnrhgryigtaypvllstn
Timeline for d2c1wc_: