Lineage for d2c0za1 (2c0z A:1-190)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1330393Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1330394Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 1330465Protein Novobiocin biosynthesis protein NovW [141587] (1 species)
  7. 1330466Species Streptomyces caeruleus [TaxId:195949] [141588] (1 PDB entry)
    Uniprot Q9L9E5 1-190
  8. 1330467Domain d2c0za1: 2c0z A:1-190 [129615]
    complexed with edo, so4

Details for d2c0za1

PDB Entry: 2c0z (more details), 1.6 Å

PDB Description: The 1.6 A resolution crystal structure of NovW: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of Streptomyces spheroides
PDB Compounds: (A:) novw

SCOPe Domain Sequences for d2c0za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]}
mrlrplgiegvweitpeqradprgvfldwyhvdrfaeaigrplrlaqanlsvsvrgvvrg
ihfvdvppgqakyvtcvrgavfdvvvdlrvgsptygcwegtrlddvsrravylsegighg
fcaisdeatlcylssgtydpatehgvhpldpelaidwptgtpllsprdqdalllaearda
gllptyatcq

SCOPe Domain Coordinates for d2c0za1:

Click to download the PDB-style file with coordinates for d2c0za1.
(The format of our PDB-style files is described here.)

Timeline for d2c0za1: