SCOPe 2.08: Domain d2c0rb_: 2c0r B:

Lineage for d2c0rb_ (2c0r B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)

7. Species Bacillus circulans, subsp. alkalophilus [TaxId:1397] [53427] (3 PDB entries)
   Uniprot Q59196

8. Domain d2c0rb_: 2c0r B: [129605]
   automated match to d1bt4a_
   complexed with plp

Details for d2c0rb_

PDB Entry: 2c0r, 1.2 Å

PDB Description: crystal structure of phosphoserine aminotransferase from bacillus circulans var. alkalophilus at ph 8.5

PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d2c0rb_:

Sequence; same for both SEQRES and ATOM records:

>d2c0rb_ c.67.1.4 (B:) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]}
seraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllal
lgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaa
sseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsr
pfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntpp
sfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnit
frlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsr
g

Timeline for d2c0rb_:

• d2c0rb_ first appeared in SCOP 1.73, called d2c0rb1
  
• d2c0rb_ appears in SCOPe 2.07