![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
![]() | Protein Phosphoserine aminotransferase, PSAT [53426] (3 species) |
![]() | Species Bacillus circulans, subsp. alkalophilus [TaxId:1397] [53427] (3 PDB entries) Uniprot Q59196 |
![]() | Domain d2c0rb_: 2c0r B: [129605] automated match to d1bt4a_ complexed with plp |
PDB Entry: 2c0r (more details), 1.2 Å
SCOPe Domain Sequences for d2c0rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0rb_ c.67.1.4 (B:) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} seraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllal lgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaa sseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsr pfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntpp sfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnit frlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsr g
Timeline for d2c0rb_: