Lineage for d2c0ra_ (2c0r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896214Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. 2896240Species Bacillus circulans, subsp. alkalophilus [TaxId:1397] [53427] (3 PDB entries)
    Uniprot Q59196
  8. 2896241Domain d2c0ra_: 2c0r A: [129604]
    automated match to d1bt4a_
    complexed with plp

Details for d2c0ra_

PDB Entry: 2c0r (more details), 1.2 Å

PDB Description: crystal structure of phosphoserine aminotransferase from bacillus circulans var. alkalophilus at ph 8.5
PDB Compounds: (A:) phosphoserine aminotransferase

SCOPe Domain Sequences for d2c0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ra_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]}
seraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllal
lgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaa
sseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsr
pfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntpp
sfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnit
frlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsr
g

SCOPe Domain Coordinates for d2c0ra_:

Click to download the PDB-style file with coordinates for d2c0ra_.
(The format of our PDB-style files is described here.)

Timeline for d2c0ra_: