Lineage for d2c07a1 (2c07 A:54-304)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090798Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 2090814Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141877] (1 PDB entry)
    Uniprot Q86RB1 54-304
  8. 2090815Domain d2c07a1: 2c07 A:54-304 [129577]
    complexed with so4

Details for d2c07a1

PDB Entry: 2c07 (more details), 1.5 Å

PDB Description: oxoacyl-acp reductase of plasmodium falciparum
PDB Compounds: (A:) 3-oxoacyl-(acyl-carrier protein) reductase

SCOPe Domain Sequences for d2c07a1:

Sequence, based on SEQRES records: (download)

>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kenyyycgenkvalvtgagrgigreiakmlaksvshvicisrtqkscdsvvdeiksfgye
ssgyagdvskkeeisevinkiltehknvdilvnnagitrdnlflrmkndewedvlrtnln
slfyitqpiskrminnrygriinissivgltgnvgqanyssskagvigftkslakelasr
nitvnaiapgfissdmtdkiseqikkniisnipagrmgtpeevanlacflssdksgying
rvfvidgglsp

Sequence, based on observed residues (ATOM records): (download)

>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kenyyycgenkvalvtgagrgigreiakmlaksvshvicisrtqkscdsvvdeiksfgye
ssgyagdvskkeeisevinkiltehknvdilvnnagitrdnlflrmkndewedvlrtnln
slfyitqpiskrminnrygriinissivgltgnvgqanyssskagvigftkslakelasr
nitvnaiapgfissiseqikkniisnipagrmgtpeevanlacflssdksgyingrvfvi
dgglsp

SCOPe Domain Coordinates for d2c07a1:

Click to download the PDB-style file with coordinates for d2c07a1.
(The format of our PDB-style files is described here.)

Timeline for d2c07a1: