SCOPe 2.08: Domain d2bz5b_: 2bz5 B:

Lineage for d2bz5b_ (2bz5 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries)

8. Domain d2bz5b_: 2bz5 B: [129551]
   automated match to d1osfa_
   complexed with ab4

Details for d2bz5b_

PDB Entry: 2bz5, 1.9 Å

PDB Description: structure-based discovery of a new class of hsp90 inhibitors

PDB Compounds: (B:) heat shock protein hsp90-alpha

SCOPe Domain Sequences for d2bz5b_:

Sequence; same for both SEQRES and ATOM records:

>d2bz5b_ d.122.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfveke

Timeline for d2bz5b_:

• d2bz5b_ first appeared in SCOP 1.73, called d2bz5b1
  
• d2bz5b_ appears in SCOPe 2.07