Lineage for d2byxd1 (2byx D:1-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916926Protein automated matches [231410] (2 species)
    not a true protein
  7. 2916927Species Escherichia coli [TaxId:562] [254877] (9 PDB entries)
  8. 2916951Domain d2byxd1: 2byx D:1-253 [129512]
    Other proteins in same PDB: d2byxa2, d2byxb2, d2byxc2, d2byxd2
    automated match to d2bywa1
    complexed with dao, nh4; mutant

Details for d2byxd1

PDB Entry: 2byx (more details), 2 Å

PDB Description: kas i lys328ala mutant in complex with fatty acid
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2byxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byxd1 c.95.1.1 (D:1-253) automated matches {Escherichia coli [TaxId: 562]}
mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d2byxd1:

Click to download the PDB-style file with coordinates for d2byxd1.
(The format of our PDB-style files is described here.)

Timeline for d2byxd1: