![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein automated matches [231410] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [254877] (9 PDB entries) |
![]() | Domain d2byxb1: 2byx B:1-253 [129508] Other proteins in same PDB: d2byxa2, d2byxb2, d2byxc2, d2byxd2 automated match to d2bywa1 complexed with dao, nh4; mutant |
PDB Entry: 2byx (more details), 2 Å
SCOPe Domain Sequences for d2byxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2byxb1 c.95.1.1 (B:1-253) automated matches {Escherichia coli [TaxId: 562]} mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv eelehalargahi
Timeline for d2byxb1: