![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins) |
![]() | Protein Chrac-16 [140400] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140401] (2 PDB entries) |
![]() | Domain d2bymc1: 2bym C:36-99 [129495] Other proteins in same PDB: d2bymb1, d2bymd1 automatically matched to 2BYK A:29-100 complexed with cd |
PDB Entry: 2bym (more details), 2.8 Å
SCOP Domain Sequences for d2bymc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bymc1 a.22.1.3 (C:36-99) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} glitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknknlefllqi vpqk
Timeline for d2bymc1: