SCOP 1.73: Domain d2bymc1: 2bym C:36-99

Lineage for d2bymc1 (2bym C:36-99)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins)

6. Protein Chrac-16 [140400] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140401] (2 PDB entries)

8. Domain d2bymc1: 2bym C:36-99 [129495]
   Other proteins in same PDB: d2bymb1, d2bymd1
   automatically matched to 2BYK A:29-100
   complexed with cd

Details for d2bymc1

PDB Entry: 2bym, 2.8 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex

PDB Compounds: (C:) chrac-16

SCOP Domain Sequences for d2bymc1:

Sequence; same for both SEQRES and ATOM records:

>d2bymc1 a.22.1.3 (C:36-99) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
glitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknknlefllqi
vpqk

Timeline for d2bymc1:

• d2bymc1 is new in SCOP 1.73
  
• d2bymc1 appears in SCOP 1.75
  
• d2bymc1 appears in the current release, SCOPe 2.07, called d2bymc_