PDB entry 2bym

View 2bym on RCSB PDB site
Description: histone fold heterodimer of the chromatin accessibility complex
Class: DNA-binding protein
Keywords: chrac-14, nucleosome sliding, histone fold, chrac-16, nucleosome sliding, DNA-binding protein
Deposited on 2005-08-03, released 2005-11-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chrac-16
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2byma1
  • Chain 'B':
    Compound: chrac-14
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bymb1
  • Chain 'C':
    Compound: chrac-16
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bymc1
  • Chain 'D':
    Compound: chrac-14
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bymd1
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bymA (A:)
    mgeprsqppverpptaetflplsrvrtimkssmdtglitnevlflmtkctelfvrhlaga
    ayteefgqrpgealkyehlsqvvnknknlefllqivpqkirvhqfqemlrlnrsagsddd
    ddddddddeeesesesesde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bymA (A:)
    tglitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknknlefllq
    ivpqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bymB (B:)
    mveriedlnlpnavigrlikealpesasvskearaaiaraasvfaifvtssstalahkqn
    hktitakdilqtlteldfesfvpsltqdlevyrkvvkekkeskaskkdsntaenanasat
    ataeeape
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bymB (B:)
    avigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdilqt
    lteldfesfvpsltqdlevyrkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bymC (C:)
    mgeprsqppverpptaetflplsrvrtimkssmdtglitnevlflmtkctelfvrhlaga
    ayteefgqrpgealkyehlsqvvnknknlefllqivpqkirvhqfqemlrlnrsagsddd
    ddddddddeeesesesesde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bymC (C:)
    glitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknknlefllqi
    vpqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bymD (D:)
    mveriedlnlpnavigrlikealpesasvskearaaiaraasvfaifvtssstalahkqn
    hktitakdilqtlteldfesfvpsltqdlevyrkvvkekkeskaskkdsntaenanasat
    ataeeape
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bymD (D:)
    navigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdilq
    tlteldfesfvpsltqdlevyrkvvk