| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
| Protein automated matches [254493] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries) |
| Domain d2bxcb2: 2bxc B:389-582 [129412] automated match to d4emxa3 complexed with p1z |
PDB Entry: 2bxc (more details), 3.1 Å
SCOPe Domain Sequences for d2bxcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxcb2 a.126.1.0 (B:389-582) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa
Timeline for d2bxcb2: