| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
| Protein automated matches [254493] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries) |
| Domain d2bxca1: 2bxc A:197-388 [129409] automated match to d4l8ua2 complexed with p1z |
PDB Entry: 2bxc (more details), 3.1 Å
SCOPe Domain Sequences for d2bxca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxca1 a.126.1.0 (A:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli
Timeline for d2bxca1: