SCOPe 2.02: Domain d2bwva1: 2bwv A:1-176

Lineage for d2bwva1 (2bwv A:1-176)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Escherichia coli [TaxId:562] [53097] (26 PDB entries)

8. Domain d2bwva1: 2bwv A:1-176 [129387]
   Other proteins in same PDB: d2bwva2
   automatically matched to d1a16_1
   complexed with cl, mn

Details for d2bwva1

PDB Entry: 2bwv, 1.7 Å

PDB Description: his361ala escherichia coli aminopeptidase p

PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d2bwva1:

Sequence; same for both SEQRES and ATOM records:

>d2bwva1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d2bwva1:

• d2bwva1 first appeared in SCOP 1.73
  
• d2bwva1 appears in SCOPe 2.01
  
• d2bwva1 appears in SCOPe 2.03
  
• d2bwva1 appears in the current release, SCOPe 2.08