Lineage for d2bwva1 (2bwv A:1-176)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) 
Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins) 
Protein automated matches [254492] (1 species)
not a true proteinSpecies Escherichia coli [TaxId:562] [255066] (7 PDB entries) 
Domain d2bwva1: 2bwv A:1-176 [129387]
Other proteins in same PDB: d2bwva2
automated match to d2v3za1
complexed with cl, mn
Details for d2bwva1
PDB Entry: 2bwv (more details), 1.7 Å
PDB Description: his361ala escherichia coli aminopeptidase p
PDB Compounds: (A:) aminopeptidase pSCOPe Domain Sequences for d2bwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwva1 c.55.2.1 (A:1-176) automated matches {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
SCOPe Domain Coordinates for d2bwva1:
Click to download the PDB-style file with coordinates for d2bwva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bwva1:
- d2bwva1 first appeared in SCOP 1.73
- d2bwva1 appears in SCOPe 2.07
View in 3D
