Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
Protein Aminopeptidase P, C-terminal domain [55928] (2 species) |
Species Escherichia coli [TaxId:562] [55929] (26 PDB entries) |
Domain d2bwsa2: 2bws A:177-440 [129382] Other proteins in same PDB: d2bwsa1 automatically matched to d1a16_2 complexed with cl, mn |
PDB Entry: 2bws (more details), 1.75 Å
SCOPe Domain Sequences for d2bwsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwsa2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilaytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaarkq
Timeline for d2bwsa2: