Lineage for d2bwsa2 (2bws A:177-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538139Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2538140Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2538141Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2538277Protein automated matches [195197] (7 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [255067] (7 PDB entries)
  8. 2538283Domain d2bwsa2: 2bws A:177-440 [129382]
    Other proteins in same PDB: d2bwsa1
    automated match to d1wl9a2
    complexed with cl, mn

Details for d2bwsa2

PDB Entry: 2bws (more details), 1.75 Å

PDB Description: his243ala escherichia coli aminopeptidase p
PDB Compounds: (A:) xaa-pro aminopeptidase p

SCOPe Domain Sequences for d2bwsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwsa2 d.127.1.1 (A:177-440) automated matches {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilaytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d2bwsa2:

Click to download the PDB-style file with coordinates for d2bwsa2.
(The format of our PDB-style files is described here.)

Timeline for d2bwsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bwsa1