![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein automated matches [195197] (6 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [255067] (7 PDB entries) |
![]() | Domain d2bwsa2: 2bws A:177-440 [129382] Other proteins in same PDB: d2bwsa1 automated match to d1wl9a2 complexed with cl, mn |
PDB Entry: 2bws (more details), 1.75 Å
SCOPe Domain Sequences for d2bwsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwsa2 d.127.1.1 (A:177-440) automated matches {Escherichia coli [TaxId: 562]} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilaytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaarkq
Timeline for d2bwsa2: