SCOPe 2.05: Domain d2bwia2: 2bwi A:167-340

Lineage for d2bwia2 (2bwi A:167-340)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (15 PDB entries)

8. Domain d2bwia2: 2bwi A:167-340 [129367]
   automated match to d1nifa2
   complexed with act, cu, mli, no2

Details for d2bwia2

PDB Entry: 2bwi, 1.1 Å

PDB Description: atomic resolution structure of nitrite -soaked achromobacter cycloclastes cu nitrite reductase

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2bwia2:

Sequence; same for both SEQRES and ATOM records:

>d2bwia2 b.6.1.3 (A:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

Timeline for d2bwia2:

• d2bwia2 first appeared in SCOP 1.73
  
• d2bwia2 appears in SCOPe 2.04
  
• d2bwia2 appears in SCOPe 2.06
  
• d2bwia2 appears in the current release, SCOPe 2.08