Class b: All beta proteins [48724] (165 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (26 PDB entries) |
Domain d2bwia2: 2bwi A:166-338 [129367] automatically matched to d1gs6x2 complexed with act, cu, mli, no2 |
PDB Entry: 2bwi (more details), 1.1 Å
SCOP Domain Sequences for d2bwia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwia2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} kgqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavg altgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipg gtagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpa
Timeline for d2bwia2: