Lineage for d2bwia2 (2bwi A:166-338)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 661004Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 661165Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (26 PDB entries)
  8. 661171Domain d2bwia2: 2bwi A:166-338 [129367]
    automatically matched to d1gs6x2
    complexed with act, cu, mli, no2

Details for d2bwia2

PDB Entry: 2bwi (more details), 1.1 Å

PDB Description: atomic resolution structure of nitrite -soaked achromobacter cycloclastes cu nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOP Domain Sequences for d2bwia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwia2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
kgqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavg
altgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipg
gtagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpa

SCOP Domain Coordinates for d2bwia2:

Click to download the PDB-style file with coordinates for d2bwia2.
(The format of our PDB-style files is described here.)

Timeline for d2bwia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bwia1