| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Beta-1,4-mannanase domain 2 (postcatalytic) [141020] (1 species) |
| Species Cellulomonas fimi [TaxId:1708] [141021] (2 PDB entries) Uniprot Q9XCV5 421-514 |
| Domain d2bvta1: 2bvt A:371-464 [129297] Other proteins in same PDB: d2bvta2, d2bvta3, d2bvtb2, d2bvtb3 complexed with cac |
PDB Entry: 2bvt (more details), 2.9 Å
SCOPe Domain Sequences for d2bvta1:
Sequence, based on SEQRES records: (download)
>d2bvta1 b.1.18.2 (A:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtldlaydgalwwt
apwsptsaqldnstytvtatattaagtldvtnev
>d2bvta1 b.1.18.2 (A:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqvvdtldlaydgalwwtapw
spytvtatattaagtldvtnev
Timeline for d2bvta1: