Lineage for d2bvta1 (2bvt A:371-464)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658686Protein Beta-1,4-mannanase domain 2 (postcatalytic) [141020] (1 species)
  7. 658687Species Cellulomonas fimi [TaxId:1708] [141021] (2 PDB entries)
  8. 658689Domain d2bvta1: 2bvt A:371-464 [129297]
    Other proteins in same PDB: d2bvta2, d2bvtb2
    complexed with bma, cac

Details for d2bvta1

PDB Entry: 2bvt (more details), 2.9 Å

PDB Description: the structure of a modular endo-beta-1,4-mannanase from cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases.
PDB Compounds: (A:) beta-1,4-mannanase

SCOP Domain Sequences for d2bvta1:

Sequence, based on SEQRES records: (download)

>d2bvta1 b.1.18.2 (A:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtldlaydgalwwt
apwsptsaqldnstytvtatattaagtldvtnev

Sequence, based on observed residues (ATOM records): (download)

>d2bvta1 b.1.18.2 (A:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqvvdtldlaydgalwwtapw
spytvtatattaagtldvtnev

SCOP Domain Coordinates for d2bvta1:

Click to download the PDB-style file with coordinates for d2bvta1.
(The format of our PDB-style files is described here.)

Timeline for d2bvta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvta2