| Class b: All beta proteins [48724] (176 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
| Species Escherichia coli [TaxId:562] [50468] (8 PDB entries) Uniprot P02990 |
| Domain d2bvnb2: 2bvn B:297-393 [129286] Other proteins in same PDB: d2bvna1, d2bvna3, d2bvnb1, d2bvnb3 automated match to d1efca2 complexed with enx, gnp, mg |
PDB Entry: 2bvn (more details), 2.3 Å
SCOPe Domain Sequences for d2bvnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvnb2 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls
Timeline for d2bvnb2: