Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) |
Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein) |
Protein Glutamine synthetase, C-terminal domain [55933] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [75542] (3 PDB entries) |
Domain d2bvcd2: 2bvc D:105-478 [129250] Other proteins in same PDB: d2bvca1, d2bvcb1, d2bvcc1, d2bvcd1, d2bvce1, d2bvcf1 automatically matched to d1htoa2 complexed with adp, cl, mg, p3s |
PDB Entry: 2bvc (more details), 2.1 Å
SCOP Domain Sequences for d2bvcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvcd2 d.128.1.1 (D:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn irphpyefalyydv
Timeline for d2bvcd2: