Lineage for d2bvca1 (2bvc A:5-104)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718125Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 718126Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 718127Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 718128Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries)
  8. 718129Domain d2bvca1: 2bvc A:5-104 [129243]
    Other proteins in same PDB: d2bvca2, d2bvcb2, d2bvcc2, d2bvcd2, d2bvce2, d2bvcf2
    automatically matched to d1htoa1
    complexed with adp, cl, mg, p3s

Details for d2bvca1

PDB Entry: 2bvc (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
PDB Compounds: (A:) glutamine synthetase 1

SCOP Domain Sequences for d2bvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvca1 d.15.9.1 (A:5-104) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOP Domain Coordinates for d2bvca1:

Click to download the PDB-style file with coordinates for d2bvca1.
(The format of our PDB-style files is described here.)

Timeline for d2bvca1: