![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) ![]() |
![]() | Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
![]() | Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries) |
![]() | Domain d2bvca1: 2bvc A:5-104 [129243] Other proteins in same PDB: d2bvca2, d2bvcb2, d2bvcc2, d2bvcd2, d2bvce2, d2bvcf2 automatically matched to d1htoa1 complexed with adp, cl, mg, p3s |
PDB Entry: 2bvc (more details), 2.1 Å
SCOP Domain Sequences for d2bvca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvca1 d.15.9.1 (A:5-104) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi hesdmlllpdpetaridpfraaktlninffvhdpftlepy
Timeline for d2bvca1: