SCOP 1.73: Domain d2bvcf2: 2bvc F:105-478

Lineage for d2bvcf2 (2bvc F:105-478)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families)

5. Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)

6. Protein Glutamine synthetase, C-terminal domain [55933] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75542] (3 PDB entries)

8. Domain d2bvcf2: 2bvc F:105-478 [129254]
   Other proteins in same PDB: d2bvca1, d2bvcb1, d2bvcc1, d2bvcd1, d2bvce1, d2bvcf1
   automatically matched to d1htoa2
   complexed with adp, cl, mg, p3s

Details for d2bvcf2

PDB Entry: 2bvc, 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic

PDB Compounds: (F:) glutamine synthetase 1

SCOP Domain Sequences for d2bvcf2:

Sequence; same for both SEQRES and ATOM records:

>d2bvcf2 d.128.1.1 (F:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

Timeline for d2bvcf2:

• d2bvcf2 is new in SCOP 1.73
  
• d2bvcf2 appears in SCOP 1.75
  
• d2bvcf2 appears in the current release, SCOPe 2.08