Lineage for d2bucb2 (2buc B:509-766)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842718Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
  6. 842725Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 842800Species Pig (Sus scrofa) [TaxId:9823] [89771] (28 PDB entries)
  8. 842862Domain d2bucb2: 2buc B:509-766 [129185]
    Other proteins in same PDB: d2buca1, d2bucb1, d2bucc1, d2bucd1
    automatically matched to d1orva2
    complexed with 008, nag, ndg, so4

Details for d2bucb2

PDB Entry: 2buc (more details), 2.5 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a tetrahydroisoquinoline inhibitor
PDB Compounds: (B:) dipeptidyl peptidase IV

SCOP Domain Sequences for d2bucb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bucb2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

SCOP Domain Coordinates for d2bucb2:

Click to download the PDB-style file with coordinates for d2bucb2.
(The format of our PDB-style files is described here.)

Timeline for d2bucb2: