SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2bucb2 (2buc B:509-766)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135563Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 protein domains)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2135570Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2135696Species Pig (Sus scrofa) [TaxId:9823] [89771] (8 PDB entries)
  8. 2135714Domain d2bucb2: 2buc B:509-766 [129185]
    Other proteins in same PDB: d2buca1, d2bucb1, d2bucc1, d2bucd1
    automated match to d1orva2
    complexed with 008, nag, ndg, so4

Details for d2bucb2

PDB Entry: 2buc (more details), 2.5 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a tetrahydroisoquinoline inhibitor
PDB Compounds: (B:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2bucb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bucb2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

SCOPe Domain Coordinates for d2bucb2:

Click to download the PDB-style file with coordinates for d2bucb2.
(The format of our PDB-style files is described here.)

Timeline for d2bucb2: