Lineage for d2btwa1 (2btw A:29-238)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015441Family d.3.1.14: Phytochelatin synthase [142867] (1 protein)
    Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit
  6. 1015442Protein Primitive phytochelatin synthase [142868] (1 species)
  7. 1015443Species Nostoc sp. PCC 7120 [TaxId:103690] [142869] (2 PDB entries)
    Uniprot Q8YY76 29-238
  8. 1015446Domain d2btwa1: 2btw A:29-238 [129159]
    complexed with ca

Details for d2btwa1

PDB Entry: 2btw (more details), 2 Å

PDB Description: crystal structure of alr0975
PDB Compounds: (A:) alr0975 protein

SCOPe Domain Sequences for d2btwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btwa1 d.3.1.14 (A:29-238) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]}
lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape
taqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtn
iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp
pvwvkttdlwkamntvdsvsqktrgfvfvs

SCOPe Domain Coordinates for d2btwa1:

Click to download the PDB-style file with coordinates for d2btwa1.
(The format of our PDB-style files is described here.)

Timeline for d2btwa1: