| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.14: Phytochelatin synthase [142867] (1 protein) Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit |
| Protein Primitive phytochelatin synthase [142868] (1 species) |
| Species Nostoc sp. PCC 7120 [TaxId:103690] [142869] (2 PDB entries) Uniprot Q8YY76 29-238 |
| Domain d2btwa1: 2btw A:29-238 [129159] complexed with ca |
PDB Entry: 2btw (more details), 2 Å
SCOPe Domain Sequences for d2btwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btwa1 d.3.1.14 (A:29-238) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]}
lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape
taqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtn
iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp
pvwvkttdlwkamntvdsvsqktrgfvfvs
Timeline for d2btwa1: