Lineage for d2btwa1 (2btw A:29-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927459Family d.3.1.14: Phytochelatin synthase [142867] (2 proteins)
    Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit
  6. 2927460Protein Primitive phytochelatin synthase [142868] (1 species)
  7. 2927461Species Nostoc sp. PCC 7120 [TaxId:103690] [142869] (2 PDB entries)
    Uniprot Q8YY76 29-238
  8. 2927464Domain d2btwa1: 2btw A:29-238 [129159]
    complexed with ca

Details for d2btwa1

PDB Entry: 2btw (more details), 2 Å

PDB Description: crystal structure of alr0975
PDB Compounds: (A:) alr0975 protein

SCOPe Domain Sequences for d2btwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btwa1 d.3.1.14 (A:29-238) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]}
lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape
taqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtn
iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp
pvwvkttdlwkamntvdsvsqktrgfvfvs

SCOPe Domain Coordinates for d2btwa1:

Click to download the PDB-style file with coordinates for d2btwa1.
(The format of our PDB-style files is described here.)

Timeline for d2btwa1: