SCOPe 2.08: Domain d2bsqa1: 2bsq A:1-138

Lineage for d2bsqa1 (2bsq A:1-138)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (4 families)

5. Family c.120.1.1: PIN domain [89619] (7 proteins)
   Pfam PF01850

6. Protein Trafficking protein B [142110] (1 species)

7. Species Neisseria gonorrhoeae [TaxId:485] [142111] (3 PDB entries)
   Uniprot Q5F882 1-138! Uniprot Q9RF91 1-138

8. Domain d2bsqa1: 2bsq A:1-138 [129098]
   Other proteins in same PDB: d2bsqa2, d2bsqb2, d2bsqc2, d2bsqd2, d2bsqe1, d2bsqf1, d2bsqg1, d2bsqh1
   protein/DNA complex

Details for d2bsqa1

PDB Entry: 2bsq, 3 Å

PDB Description: fitab bound to dna

PDB Compounds: (A:) trafficking protein b

SCOPe Domain Sequences for d2bsqa1:

Sequence; same for both SEQRES and ATOM records:

>d2bsqa1 c.120.1.1 (A:1-138) Trafficking protein B {Neisseria gonorrhoeae [TaxId: 485]}
milldtnviseplrpqpnervvawldsliledvylsaitvaemrlgvalllngkkknvlh
ermeqsilplfagrilpfdepvaaiyaqirsyakthgkeiaaadgyiaatakqhsmtvat
rdtgsffaadvavfnpwh

Timeline for d2bsqa1:

• d2bsqa1 first appeared in SCOP 1.73
  
• d2bsqa1 appears in SCOPe 2.07