| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (4 families) ![]() |
| Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
| Protein Trafficking protein B [142110] (1 species) |
| Species Neisseria gonorrhoeae [TaxId:485] [142111] (3 PDB entries) Uniprot Q5F882 1-138! Uniprot Q9RF91 1-138 |
| Domain d2bsqc1: 2bsq C:1-138 [129100] Other proteins in same PDB: d2bsqa2, d2bsqb2, d2bsqc2, d2bsqd2, d2bsqe1, d2bsqf1, d2bsqg1, d2bsqh1 automatically matched to 2BSQ A:1-138 protein/DNA complex |
PDB Entry: 2bsq (more details), 3 Å
SCOPe Domain Sequences for d2bsqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bsqc1 c.120.1.1 (C:1-138) Trafficking protein B {Neisseria gonorrhoeae [TaxId: 485]}
milldtnviseplrpqpnervvawldsliledvylsaitvaemrlgvalllngkkknvlh
ermeqsilplfagrilpfdepvaaiyaqirsyakthgkeiaaadgyiaatakqhsmtvat
rdtgsffaadvavfnpwh
Timeline for d2bsqc1: