Lineage for d2bsqd1 (2bsq D:1-138)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921860Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2921909Protein Trafficking protein B [142110] (1 species)
  7. 2921910Species Neisseria gonorrhoeae [TaxId:485] [142111] (3 PDB entries)
    Uniprot Q5F882 1-138! Uniprot Q9RF91 1-138
  8. 2921919Domain d2bsqd1: 2bsq D:1-138 [129101]
    Other proteins in same PDB: d2bsqa2, d2bsqb2, d2bsqc2, d2bsqd2, d2bsqe1, d2bsqf1, d2bsqg1, d2bsqh1
    automatically matched to 2BSQ A:1-138
    protein/DNA complex

Details for d2bsqd1

PDB Entry: 2bsq (more details), 3 Å

PDB Description: fitab bound to dna
PDB Compounds: (D:) trafficking protein b

SCOPe Domain Sequences for d2bsqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsqd1 c.120.1.1 (D:1-138) Trafficking protein B {Neisseria gonorrhoeae [TaxId: 485]}
milldtnviseplrpqpnervvawldsliledvylsaitvaemrlgvalllngkkknvlh
ermeqsilplfagrilpfdepvaaiyaqirsyakthgkeiaaadgyiaatakqhsmtvat
rdtgsffaadvavfnpwh

SCOPe Domain Coordinates for d2bsqd1:

Click to download the PDB-style file with coordinates for d2bsqd1.
(The format of our PDB-style files is described here.)

Timeline for d2bsqd1: