Lineage for d2bsla_ (2bsl A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1567263Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1567264Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1567647Protein automated matches [190228] (14 species)
    not a true protein
  7. 1567662Species Lactococcus lactis [TaxId:1358] [186992] (2 PDB entries)
  8. 1567665Domain d2bsla_: 2bsl A: [129095]
    automated match to d1dora_
    complexed with act, dhb, fmn, gol, mg

Details for d2bsla_

PDB Entry: 2bsl (more details), 2.3 Å

PDB Description: crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,4-dihydroxybenzoate
PDB Compounds: (A:) dihydroorotate dehydrogenase a

SCOPe Domain Sequences for d2bsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsla_ c.1.4.1 (A:) automated matches {Lactococcus lactis [TaxId: 1358]}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOPe Domain Coordinates for d2bsla_:

Click to download the PDB-style file with coordinates for d2bsla_.
(The format of our PDB-style files is described here.)

Timeline for d2bsla_: