Lineage for d2bskf1 (2bsk F:13-73)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2265177Fold g.83: Tim10-like [144121] (1 superfamily)
    alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure
  4. 2265178Superfamily g.83.1: Tim10-like [144122] (2 families) (S)
  5. 2265179Family g.83.1.1: Tim10/DDP [144123] (2 proteins)
    Pfam PF02953; note: not a zinc finger
  6. 2265180Protein Mitochondrial import inner membrane translocase subunit Tim10 [144126] (1 species)
  7. 2265181Species Human (Homo sapiens) [TaxId:9606] [144127] (1 PDB entry)
    Uniprot P62072 13-77
  8. 2265184Domain d2bskf1: 2bsk F:13-73 [129094]
    Other proteins in same PDB: d2bska1, d2bskc1
    automatically matched to 2BSK B:13-77

Details for d2bskf1

PDB Entry: 2bsk (more details), 3.3 Å

PDB Description: crystal structure of the tim9 tim10 hexameric complex
PDB Compounds: (F:) mitochondrial import inner membrane translocase subunit tim10

SCOPe Domain Sequences for d2bskf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bskf1 g.83.1.1 (F:13-73) Mitochondrial import inner membrane translocase subunit Tim10 {Human (Homo sapiens) [TaxId: 9606]}
levemmadmynrmtsachrkcvpphykeaelskgesvcldrcvskyldihermgkkltel
s

SCOPe Domain Coordinates for d2bskf1:

Click to download the PDB-style file with coordinates for d2bskf1.
(The format of our PDB-style files is described here.)

Timeline for d2bskf1: