Lineage for d2bsdb1 (2bsd B:162-264)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. Protein receptor binding protein, rbp, C-terminal domain [141125] (1 species)
  7. Species Lactococcus lactis phage p2 [TaxId:100641] [141126] (3 PDB entries)
    Uniprot Q71AW2 162-264
  8. Domain d2bsdb1: 2bsd B:162-264 [129084]
    Other proteins in same PDB: d2bsda2, d2bsda3, d2bsdb2, d2bsdb3, d2bsdc2, d2bsdc3
    automated match to d1zrua1

Details for d2bsdb1

PDB Entry: 2bsd (more details), 2.3 Å

PDB Description: structure of lactococcal bacteriophage p2 receptor binding protein
PDB Compounds: (B:) receptor binding protein

SCOPe Domain Sequences for d2bsdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsdb1 b.21.1.3 (B:162-264) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
pvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslv
ghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik

SCOPe Domain Coordinates for d2bsdb1 are not available.

Timeline for d2bsdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bsdb2, d2bsdb3
View in 3D
Domains from other chains:
(mouse over for more information)
d2bsda1, d2bsda2, d2bsda3, d2bsdc1, d2bsdc2, d2bsdc3