Lineage for d2bsdc1 (2bsd C:162-264)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777048Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 2777054Protein receptor binding protein, rbp, C-terminal domain [141125] (1 species)
  7. 2777055Species Lactococcus lactis phage p2 [TaxId:100641] [141126] (3 PDB entries)
    Uniprot Q71AW2 162-264
  8. 2777061Domain d2bsdc1: 2bsd C:162-264 [129087]
    Other proteins in same PDB: d2bsda2, d2bsda3, d2bsdb2, d2bsdb3, d2bsdc2, d2bsdc3
    automated match to d1zrua1

Details for d2bsdc1

PDB Entry: 2bsd (more details), 2.3 Å

PDB Description: structure of lactococcal bacteriophage p2 receptor binding protein
PDB Compounds: (C:) receptor binding protein

SCOPe Domain Sequences for d2bsdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsdc1 b.21.1.3 (C:162-264) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
pvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslv
ghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik

SCOPe Domain Coordinates for d2bsdc1:

Click to download the PDB-style file with coordinates for d2bsdc1.
(The format of our PDB-style files is described here.)

Timeline for d2bsdc1: