Lineage for d1zrua1 (1zru A:162-264)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777048Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 2777054Protein receptor binding protein, rbp, C-terminal domain [141125] (1 species)
  7. 2777055Species Lactococcus lactis phage p2 [TaxId:100641] [141126] (3 PDB entries)
    Uniprot Q71AW2 162-264
  8. 2777056Domain d1zrua1: 1zru A:162-264 [125560]
    Other proteins in same PDB: d1zrua2, d1zrua3, d1zrub2, d1zrub3, d1zruc2, d1zruc3
    complexed with gol

Details for d1zrua1

PDB Entry: 1zru (more details), 1.73 Å

PDB Description: structure of the lactophage p2 receptor binding protein in complex with glycerol
PDB Compounds: (A:) lactophage p2 receptor binding protein

SCOPe Domain Sequences for d1zrua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrua1 b.21.1.3 (A:162-264) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
pvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslv
ghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik

SCOPe Domain Coordinates for d1zrua1:

Click to download the PDB-style file with coordinates for d1zrua1.
(The format of our PDB-style files is described here.)

Timeline for d1zrua1: