SCOP 1.75: Domain d2bsaa2: 2bsa A:142-302

Lineage for d2bsaa2 (2bsa A:142-302)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (24 PDB entries)

8. Domain d2bsaa2: 2bsa A:142-302 [129079]
   Other proteins in same PDB: d2bsaa1
   automatically matched to d1ewya2
   complexed with fad, nap; mutant

Details for d2bsaa2

PDB Entry: 2bsa, 1.92 Å

PDB Description: ferredoxin-nadp reductase (mutation: y 303 s) complexed with nadp

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOP Domain Sequences for d2bsaa2:

Sequence; same for both SEQRES and ATOM records:

>d2bsaa2 c.25.1.1 (A:142-302) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvet

Timeline for d2bsaa2:

• d2bsaa2 first appeared in SCOP 1.73
  
• d2bsaa2 appears in SCOPe 2.01
  
• d2bsaa2 appears in the current release, SCOPe 2.08