SCOPe 2.08: Domain d2bsaa2: 2bsa A:142-303

Lineage for d2bsaa2 (2bsa A:142-303)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein automated matches [226995] (7 species)
   not a true protein

7. Species Anabaena sp. [TaxId:1167] [229046] (3 PDB entries)

8. Domain d2bsaa2: 2bsa A:142-303 [129079]
   Other proteins in same PDB: d2bsaa1
   automated match to d1ewya2
   complexed with fad, nap; mutant

Details for d2bsaa2

PDB Entry: 2bsa, 1.92 Å

PDB Description: ferredoxin-nadp reductase (mutation: y 303 s) complexed with nadp

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2bsaa2:

Sequence; same for both SEQRES and ATOM records:

>d2bsaa2 c.25.1.1 (A:142-303) automated matches {Anabaena sp. [TaxId: 1167]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvets

Timeline for d2bsaa2:

• d2bsaa2 first appeared in SCOP 1.73
  
• d2bsaa2 appears in SCOPe 2.07