Lineage for d2bs3d2 (2bs3 D:1-250,D:372-457)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1154265Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1154266Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1154657Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 1154696Protein Fumarate reductase [51937] (2 species)
  7. 1154708Species Wolinella succinogenes [TaxId:844] [51939] (5 PDB entries)
  8. 1154712Domain d2bs3d2: 2bs3 D:1-250,D:372-457 [129048]
    Other proteins in same PDB: d2bs3a1, d2bs3a3, d2bs3b1, d2bs3b2, d2bs3c1, d2bs3d1, d2bs3d3, d2bs3e1, d2bs3e2, d2bs3f_
    automatically matched to d1e7pa2
    complexed with cit, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs3d2

PDB Entry: 2bs3 (more details), 2.19 Å

PDB Description: glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (D:) quinol-fumarate reductase flavoprotein subunit a

SCOPe Domain Sequences for d2bs3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs3d2 c.3.1.4 (D:1-250,D:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
letgiaqlgnXmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
geyfaehcantqvdletktlekfvkgqeaymkslves

SCOPe Domain Coordinates for d2bs3d2:

Click to download the PDB-style file with coordinates for d2bs3d2.
(The format of our PDB-style files is described here.)

Timeline for d2bs3d2: