Lineage for d2bs3a1 (2bs3 A:458-655)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081581Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1081658Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1081659Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1081666Protein Fumarate reductase [46981] (2 species)
  7. 1081678Species Wolinella succinogenes [TaxId:844] [46983] (5 PDB entries)
  8. 1081681Domain d2bs3a1: 2bs3 A:458-655 [129042]
    Other proteins in same PDB: d2bs3a2, d2bs3a3, d2bs3b1, d2bs3b2, d2bs3c1, d2bs3d2, d2bs3d3, d2bs3e1, d2bs3e2, d2bs3f_
    automatically matched to d1e7pa1
    complexed with cit, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs3a1

PDB Entry: 2bs3 (more details), 2.19 Å

PDB Description: glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (A:) quinol-fumarate reductase flavoprotein subunit a

SCOPe Domain Sequences for d2bs3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs3a1 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
kgtedvfkiknrmkdvmddnvgifrdgphlekavkeleelykksknvgiknkrlhanpel
eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt
leyealdvnemeiapgyrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal
mpyelpakykarnerlgd

SCOPe Domain Coordinates for d2bs3a1:

Click to download the PDB-style file with coordinates for d2bs3a1.
(The format of our PDB-style files is described here.)

Timeline for d2bs3a1: