SCOPe 2.01: Domain d2brrl2: 2brr L:108-214

Lineage for d2brrl2 (2brr L:108-214)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d2brrl2: 2brr L:108-214 [129012]
   Other proteins in same PDB: d2brrh1, d2brrl1, d2brrx1, d2brry1
   automatically matched to d1hzhl2
   complexed with acy, so4

Details for d2brrl2

PDB Entry: 2brr, 1.95 Å

PDB Description: Complex of the neisserial PorA P1.4 epitope peptide and two Fab- fragments (antibody MN20B9.34)

PDB Compounds: (L:) mn20b9.34 anti-p1.4 antibody, fab light chain

SCOPe Domain Sequences for d2brrl2:

Sequence; same for both SEQRES and ATOM records:

>d2brrl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2brrl2:

• d2brrl2 first appeared in SCOP 1.73
  
• d2brrl2 appears in SCOP 1.75
  
• d2brrl2 appears in SCOPe 2.02
  
• d2brrl2 appears in the current release, SCOPe 2.08