SCOPe 2.01: Domain d2bp6c_: 2bp6 C:

Lineage for d2bp6c_ (2bp6 C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)

6. Protein automated matches [190094] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [186987] (2 PDB entries)

8. Domain d2bp6c_: 2bp6 C: [128924]
   automated match to d1gzta_
   complexed with ca, gxl, so4

Details for d2bp6c_

PDB Entry: 2bp6, 1.5 Å

PDB Description: crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with a-l-galactopyranoside

PDB Compounds: (C:) pseudomonas aeruginosa lectin II

SCOPe Domain Sequences for d2bp6c_:

Sequence; same for both SEQRES and ATOM records:

>d2bp6c_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d2bp6c_:

• d2bp6c_ first appeared in SCOP 1.73, called d2bp6c1
  
• d2bp6c_ was called d2bp6c1 in SCOP 1.75
  
• d2bp6c_ appears in SCOPe 2.02
  
• d2bp6c_ appears in the current release, SCOPe 2.08