Class b: All beta proteins [48724] (174 folds) |
Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) |
Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins) |
Protein automated matches [190094] (2 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [186987] (2 PDB entries) |
Domain d2bp6c_: 2bp6 C: [128924] automated match to d1gzta_ complexed with ca, gxl, so4 |
PDB Entry: 2bp6 (more details), 1.5 Å
SCOPe Domain Sequences for d2bp6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bp6c_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
Timeline for d2bp6c_: