![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
![]() | Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) ![]() |
![]() | Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins) automatically mapped to Pfam PF07472 |
![]() | Protein automated matches [190094] (4 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [186987] (2 PDB entries) |
![]() | Domain d2bp6c_: 2bp6 C: [128924] automated match to d1gzta_ complexed with ca, gxl, so4 |
PDB Entry: 2bp6 (more details), 1.5 Å
SCOPe Domain Sequences for d2bp6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bp6c_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
Timeline for d2bp6c_: