Lineage for d2bp6a_ (2bp6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821276Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2821277Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2821278Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 2821332Protein automated matches [190094] (4 species)
    not a true protein
  7. 2821416Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [186987] (2 PDB entries)
  8. 2821417Domain d2bp6a_: 2bp6 A: [128922]
    automated match to d1gzta_
    complexed with ca, gxl, so4

Details for d2bp6a_

PDB Entry: 2bp6 (more details), 1.5 Å

PDB Description: crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with a-l-galactopyranoside
PDB Compounds: (A:) pseudomonas aeruginosa lectin II

SCOPe Domain Sequences for d2bp6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp6a_ b.115.1.1 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d2bp6a_:

Click to download the PDB-style file with coordinates for d2bp6a_.
(The format of our PDB-style files is described here.)

Timeline for d2bp6a_: